Search Results: 3,732 vacancies
...representing one or the other. Conducts market and sub-market analysis on rents, demographics, supply & demand, sales comparables, lease comparables to create informed data driven strategies, programs and methods to improve the financial and operational return on assigned...
...property tours as part of marketing activities.
Screening prospective tenants to ensure they meet eligibility requirements.
Completing lease applications and assisting with verification of application information.
Informing prospective tenants of results.
Inspecting...
REQUIREMENTS
Experience: 3 years minimum . Nationality: pakistani preferred PROVISIONS
Medical insurance provided . Accommodation Salary: Negotiable
Looking for Leasing Consultant preferable with UAE experience. REQUIREMENTS
Experience: 2 - 3 years Salary: Negotiable
Leasing Consultant required. Ones on visit visa can apply. REQUIREMENTS
Experience: 3 - 5 years . Nationality: filipino preferred PROVISIONS
Medical insurance provided . Accommodation provided Salary: Negotiable
We are hiring: Leasing Consultant REQUIREMENTS
Experience: 1 - 3 years PROVISIONS
Medical insurance provided Salary: Negotiable
Leasing Consultant required urgently. REQUIREMENTS
Experience: 3 - 5 years . Nationality: pakistani preferred PROVISIONS
Residence visa provided . Medical insurance provided Salary: Negotiable
Honest and self-motivated Leasing Consultant required for a reputed company. REQUIREMENTS
- Preferably having a UAE valid driving license
- Proven working experience as a Real Estate Agent or Real Estate Salesperson
- Proven track of successful sales record
-...
Looking for Leasing Consultant REQUIREMENTS
Experience: at least 1 year PROVISIONS
Employment visa provided . Transport provided . Medical insurance Salary: Negotiable
We are looking to hire Self Motivated, Highly Ambitious, and Result Oriented Real Estate Agents for the Secondary Market to join our growing team!
The ideal candidate will be responsible for finding prospective clients and understanding their criteria.
Qualifications...
We are hiring: Leasing Consultant REQUIREMENTS
Requirements:
3+ work experience as a Leasing Agent or similar position.
Proficient knowledge of real estate industry, property management principles and relevant legislation.
Valid driver’s license and own reliable...
Leasing Consultant with or without UAE experience required. REQUIREMENTS
Experience: 1 - 2 years PROVISIONS
Employment visa provided . Medical insurance . Accommodation Salary: Negotiable
....
Location: Dubai
Job Type: Contractual
Duration 6 months
Responsibilities
To manage, consult, teach, troubleshoot, setup and maintain automotive leasing application and other domain applications assigned to agreed service level standards.
Investigates...
NorthBay Solutions
Lahore
1 day ago
Looking for Leasing Consultant preferable with UAE experience.
Should be ready to relocate to Dubai REQUIREMENTS
Experience: 3 - 5 years PROVISIONS
Residence visa provided . Accommodation Salary: Negotiable
Responsible and hard working Leasing Consultant required for a reputed company. REQUIREMENTS
Experience: 2 - 3 years . Nationality: filipino preferred PROVISIONS
Medical insurance Salary: Negotiable
Job Description
(adsbygoogle = window.adsbygoogle || []).push({});
ALS started operations in and over the years has seen steady growth ever since. Today, as an industry leader, ALS offers a range of customized and comprehensive aviation solutions for the benefit...
confidential
Balochistan
4 days ago
...tax disciplines to help our clients thrive in an era of rapid change. We combine our exceptional knowledge and experience with the people and technology platforms that make us an ideal partner for all ...
Senior Consultant professionals in Karachi
#J-18808-Ljbffr
Job Portal - dinCloud Pakistan
Karachi
13 hours ago
...We have an Urgent need for a Senior Microsoft Dynamics 365 Finance Consultant. We’re growing and looking for experienced Senior Consultants with solid knowledge and experience in Dynamics 365 Finance with Project Accounting. We are looking for passionate candidates who...
Yasoob Consulting
Islamabad
1 day ago
...Work permit for Kenya (if applicable)
Nice to Have
Result oriented and outgoing personality
Previous experience in Sales or Consultancy
Knowledge of ERP and SaaS software
Workhard/playhardattitude
Ability toperforminafast-pacedanddynamicenvironment...
confidential
Balochistan
13 hours ago
...Join our dynamic team as a Sales Consultant and embark on a rewarding career in the insurance industry. As a key member of our sales team, you will play a crucial role in promoting our insurance products and services to prospective clients. This position offers an exciting...
Wholy Digital Group
Lahore
1 day ago
